NeuroPred-PLM: an interpretable and robust model for prediction of neuropeptides by protein language model
To install requirements:
# latest version
pip install git+https://github.com/ISYSLAB-HUST/NeuroPred-PLM.git
# stable version
pip install NeuroPredPLM
import torch
from NeuroPredPLM.predict import predict
data = [
("peptide_1", "IGLRLPNMLKF"),
("peptide_2", "QAAQFKVWSASELVD"),
("peptide_3","LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY")
]
device = "cuda" if torch.cuda.is_available() else "cpu"
neuropeptide_pred = predict(data,device)
# {peptide_id:[Type:int(1->neuropeptide,0->non-neuropeptide), attention score:nd.array]}
Released under the MIT license.
If you have any questions, comments, or would like to report a bug, please file a Github issue or contact me at [email protected].